PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010910788.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GATA
Protein Properties Length: 283aa    MW: 31350.5 Da    PI: 8.4765
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010910788.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.58e-18212246135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  XP_010910788.1 212 CTHCLSQKTPQWRAGPLGPKTLCNACGVRFKSGRL 246
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.6E-16206260IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.174206242IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14208270No hitNo description
Gene3DG3DSA:3.30.50.101.3E-13210244IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.68E-13211268No hitNo description
PfamPF003201.5E-15212246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAVLSLSLQL TEPHEKKTPL SLSTMDQQDM DLYQNLPASG GLPAKGSSAA SSTFEDFLPG  60
GLTEGEDVSL EWLSIFVEDC LSSTTNYNSQ HLPPPTTITN SPQLQTPTAY SKPPPPQTPK  120
PSFHVLEGPS RYRSKRRKTT PRSRPHDQNY TLHVIPSDPP LLHQTHWLAD SELIFPKKEQ  180
EDKPSEPALV GGVEGEEEKM GKDGAMVQPR RCTHCLSQKT PQWRAGPLGP KTLCNACGVR  240
FKSGRLLPEY RPAKSPTFVS YKHSNSHKKV MEMRMAILSS HSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910788.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLF6HLA64e-75F6HLA6_VITVI; Putative uncharacterized protein
TrEMBLM0SQV22e-75M0SQV2_MUSAM; Uncharacterized protein
STRINGVIT_08s0007g07550.t011e-74(Vitis vinifera)
STRINGGSMUA_Achr4P21390_0015e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.12e-36GATA transcription factor 4